SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10635_internal:A_BomoASG_c26454_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		SCY1-like_protein_2_[Bombyx_mori]
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0004672 F protein kinase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0006468 P protein phosphorylation
GO:0008333 P endosome to lysosome transport
GO:0010008 C endosome membrane
GO:0016020 C membrane
GO:0030136 C clathrin-coated vesicle
GO:0031410 C cytoplasmic vesicle
GO:0048471 C perinuclear region of cytoplasm
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:2000286 P receptor internalization involved in canonical Wnt signaling pathway
GO:2000370 P positive regulation of clathrin-dependent endocytosis
RNA-seq EntryA_BomoASG_c26454_g1_i1
Sequence
(Amino Acid)
DRKSVYKGYKKSTKQEASIFVFEKKQLDRWQKADRDIMLETLKRGIIQLTKLRHPQILTV
QHSLEESRESLAFATEPVFASLANILGYTENMPQPIPGQIG
(32 a.a.)

- SilkBase 1999-2023 -