SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10630_internal:A_BomoASG_c26446_g1_i3
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		protein_abrupt_isoform_X2_[Bombyx_mori]
Ontology
GO:0000785 C chromatin
GO:0000794 C condensed nuclear chromosome
GO:0001672 P regulation of chromatin assembly or disassembly
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005704 C polytene chromosome band
GO:0005730 C nucleolus
GO:0005886 C plasma membrane
GO:0006325 P chromatin organization
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006915 P apoptotic process
GO:0007060 P male meiosis chromosome segregation
GO:0007141 P male meiosis I
GO:0008195 F phosphatidate phosphatase activity
GO:0008354 P germ cell migration
GO:0010032 P meiotic chromosome condensation
GO:0016311 P dephosphorylation
GO:0016568 P chromatin organization
GO:0031208 F POZ domain binding
GO:0042803 F protein homodimerization activity
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
RNA-seq EntryA_BomoASG_c26446_g1_i3
Sequence
(Amino Acid)
ALPIWHLLQAHKVILSICSPYFKKMFLMNPCQHPIIVLRDVTHKAMRDLLQFMYHGEVSV
KREDLTSFIGTAEVLQIKGLTNKETEEEEIEKEQNLSKQTLEAQNILETDSHNTENYDHS
DETTNSELILLKQRQFIEKLQRLSNLKRKSEDYLQNNYFDVANSEKRPKIKEKTYNKHNH
(59 a.a.)

- SilkBase 1999-2023 -