SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10610_internal:A_BomoASG_c26439_g1_i2
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		protein_lines_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007362 P terminal region determination
GO:0007367 P segment polarity determination
GO:0007440 P foregut morphogenesis
GO:0007442 P hindgut morphogenesis
GO:0008293 P torso signaling pathway
GO:0008544 P epidermis development
GO:0009880 P embryonic pattern specification
GO:0009946 P proximal/distal axis specification
GO:0016055 P Wnt signaling pathway
GO:0035220 P wing disc development
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048617 P embryonic foregut morphogenesis
GO:0048619 P embryonic hindgut morphogenesis
RNA-seq EntryA_BomoASG_c26439_g1_i2
Sequence
(Amino Acid)
SEERHRQLNISTWPLTSSLTYLSTMQLMFDIYLKQNGTGTICSKVMQACDLLVRNRHDWI
TEVVELADHKSKYITFIASRVLATFLIVSKDTVDENWLQQIAENIYLFDRINRI
(37 a.a.)

- SilkBase 1999-2023 -