SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1047_complete:A_BomoASG_c6492_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		Rab7_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000421 C autophagosome membrane
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005774 C vacuolar membrane
GO:0005794 C Golgi apparatus
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0006622 P protein targeting to lysosome
GO:0006629 P lipid metabolic process
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006913 P nucleocytoplasmic transport
GO:0006914 P autophagy
GO:0007165 P signal transduction
GO:0007174 P epidermal growth factor catabolic process
GO:0007264 P small GTPase mediated signal transduction
GO:0008333 P endosome to lysosome transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0019003 F GDP binding
GO:0019076 P viral release from host cell
GO:0022615 P protein to membrane docking
GO:0030670 C phagocytic vesicle membrane
GO:0030904 C retromer complex
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0032419 C extrinsic component of lysosome membrane
GO:0033162 C melanosome membrane
GO:0034045 C phagophore assembly site membrane
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043231 C intracellular membrane-bounded organelle
GO:0045022 P early endosome to late endosome transport
GO:0045335 C phagocytic vesicle
GO:0045732 P positive regulation of protein catabolic process
GO:0048524 P positive regulation of viral process
GO:0061724 P lipophagy
GO:0070062 C extracellular exosome
GO:0090383 P phagosome acidification
GO:0090385 P phagosome-lysosome fusion
GO:1903543 P positive regulation of exosomal secretion
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoASG_c6492_g1_i1
Sequence
(Amino Acid)
MSSRKKLLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF
VILGNKVDLDNRAVSVKRGQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA
ELYNEFPDQIKLNANDNGRNRDGDNCAC
*(68 a.a.)

- SilkBase 1999-2023 -