SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10474_complete:A_BomoASG_c26347_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		K3_protein_[Bombyx_mori]
Ontology
GO:0001784 F phosphotyrosine residue binding
GO:0005070 F obsolete SH3/SH2 adaptor activity
GO:0005154 F epidermal growth factor receptor binding
GO:0005168 F neurotrophin TRKA receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0007265 P Ras protein signal transduction
GO:0007568 P aging
GO:0008180 C COP9 signalosome
GO:0008286 P insulin receptor signaling pathway
GO:0009967 P positive regulation of signal transduction
GO:0012506 C vesicle membrane
GO:0016020 C membrane
GO:0017124 F SH3 domain binding
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0019904 F protein domain specific binding
GO:0030154 P cell differentiation
GO:0030838 P positive regulation of actin filament polymerization
GO:0031623 P receptor internalization
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0042770 P signal transduction in response to DNA damage
GO:0042802 F identical protein binding
GO:0043234 C protein-containing complex
GO:0043408 P regulation of MAPK cascade
GO:0043560 F insulin receptor substrate binding
GO:0044822 F RNA binding
GO:0046875 F ephrin receptor binding
GO:0048646 P anatomical structure formation involved in morphogenesis
GO:0051219 F phosphoprotein binding
GO:0051291 P protein heterooligomerization
GO:0060670 P branching involved in labyrinthine layer morphogenesis
GO:0070062 C extracellular exosome
GO:0070436 C Grb2-EGFR complex
GO:0071479 P cellular response to ionizing radiation
GO:2000379 P positive regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomoASG_c26347_g1_i1
Sequence
(Amino Acid)
MAFLCPVRIRRGKKKKSSSGDSDKDLSRPSSGLSPGMGRITGSASIETLVRVGIEKEHGL
SPDSKMVVLHDFTPCVDDELEVKRGQIVNVLYRENDWVYVIVAESRREGFIPHSYCAPCE
HHDLKKKLPRSRSPADLAHRDVSQLSVSDGVTNDGHSELGSEGEACPFSKDPSGRYVVLY
TFTARDENDVDVERGEFVTVLNREDPDWYWIVRSDGQEGFIPSGFVYPAVVQGSST
*(78 a.a.)

- SilkBase 1999-2023 -