SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10449_5prime_partial:A_BomoASG_c26320_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		protein_crumbs_[Bombyx_mori]
Ontology
GO:0001738 P morphogenesis of a polarized epithelium
GO:0001745 P compound eye morphogenesis
GO:0002009 P morphogenesis of an epithelium
GO:0005080 F protein kinase C binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005913 C adherens junction
GO:0005918 C septate junction
GO:0007043 P cell-cell junction assembly
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007424 P open tracheal system development
GO:0007431 P salivary gland development
GO:0007435 P salivary gland morphogenesis
GO:0007443 P Malpighian tubule morphogenesis
GO:0008104 P protein localization
GO:0008284 P positive regulation of cell population proliferation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016028 C rhabdomere
GO:0016324 C apical plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0030154 P cell differentiation
GO:0030507 F spectrin binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032880 P regulation of protein localization
GO:0033157 P regulation of intracellular protein transport
GO:0034332 P adherens junction organization
GO:0035002 P liquid clearance, open tracheal system
GO:0035003 C subapical complex
GO:0035088 P establishment or maintenance of apical/basal cell polarity
GO:0035090 P maintenance of apical/basal cell polarity
GO:0035239 P tube morphogenesis
GO:0035330 P regulation of hippo signaling
GO:0042051 P compound eye photoreceptor development
GO:0042052 P rhabdomere development
GO:0042327 P positive regulation of phosphorylation
GO:0045186 P zonula adherens assembly
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045218 P zonula adherens maintenance
GO:0045494 P photoreceptor cell maintenance
GO:0045570 P regulation of imaginal disc growth
GO:0045746 P negative regulation of Notch signaling pathway
GO:0046621 P negative regulation of organ growth
GO:0046664 P dorsal closure, amnioserosa morphology change
GO:0048477 P oogenesis
GO:0050821 P protein stabilization
GO:0051642 P centrosome localization
GO:0061024 P membrane organization
GO:0061336 P cell morphogenesis involved in Malpighian tubule morphogenesis
GO:0061541 P rhabdomere morphogenesis
GO:0098813 P nuclear chromosome segregation
RNA-seq EntryA_BomoASG_c26320_g1_i1
Sequence
(Amino Acid)
LLARHPLPPPTDLTITYRTKVGGTLLRAESDPSEGQEGSWFAVGAYKERVSVQWRLDPLG
GPPADLPRALRMTAPHSHLHWTTVKFTFDRDQIIGSFVEADGEERVGLRGHIDVAAWQRL
VSAGRILLGGGGRAPAAPPPPTLNMETSTDQAYEFTEGEEFAADNIEGKYFKGCVGAVHV
GGLLLPFFTEEKLFVGPAAALLAAQPHYALISGVPWGAAEGVGCVLCLEADCNNGGRCAD
VRSSYSCSCPPGYSGDYCQVDIDECAVHECQHGATCRDLVAAYRCECPPGFEGQLCESDI
DECTSSPCANGGTCVDAPGGYTCTCSPQWRGDTCREPRARTCAHSPCAPGAARCTDDPPD
PPTGNKFTCECREGYEGVYCEKPFCEVTPCVHGECRADAQGVQCACAPGWTGARCSEERD
ECVGHCQHGGRCYRDSEHFLCDCTATGWTGARCEVDVDECAEGLVSCGPGDCRNLNGSYT
CVCGRGYCGAECALVDPCGAEPCQHGAVCEQRCAREPDYVCRCTDGWAGKNCTQQAVAEG
SEGTSDNSSAVLLGVGGALVALALAGGALGALGAQARRKRATRGTYSPSGQEYCNPRAEM
HHHALKPPPEERLI
*(204 a.a.)

- SilkBase 1999-2023 -