SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG10445_5prime_partial:A_BomoASG_c26318_g2_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
probable_phospholipid-transporting_ATPase_IA_isoform_X2_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004012 F ATPase-coupled intramembrane lipid transporter activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0007612 P learning
GO:0008152 P metabolic process
GO:0015914 P phospholipid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019829 F ATPase-coupled cation transmembrane transporter activity
GO:0030335 P positive regulation of cell migration
GO:0031410 C cytoplasmic vesicle
GO:0034220 P ion transmembrane transport
GO:0042584 C chromaffin granule membrane
GO:0043231 C intracellular membrane-bounded organelle
GO:0045332 P phospholipid translocation
GO:0046872 F metal ion binding
GO:0048194 P Golgi vesicle budding
GO:0061092 P positive regulation of phospholipid translocation
GO:0070062 C extracellular exosome
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomoASG_c26318_g2_i1
Sequence
(Amino Acid)
LVVTVVRNSAFKSATEAVRESELKQRAPPALLAQPRHSLTETARLLQNVRSVFTRRSTSR
AAVELELSHGFAFSQEEGGSVSQADVVRVYDTRQPRPEHS
*(32 a.a.)

- SilkBase 1999-2023 -