SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10414_internal:A_BomoASG_c26306_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_uncharacterized_protein_LOC101737263_[Bombyx_mori]
Ontology
GO:0000785 C chromatin
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0010906 P regulation of glucose metabolic process
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0018991 P oviposition
GO:0032259 P methylation
GO:0034770 P histone H4-K20 methylation
GO:0035035 F histone acetyltransferase binding
GO:0042054 F histone methyltransferase activity
GO:0042799 F histone methyltransferase activity (H4-K20 specific)
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0042802 F identical protein binding
GO:0043234 C protein-containing complex
GO:0046872 F metal ion binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0048096 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0048477 P oogenesis
GO:0051567 P histone H3-K9 methylation
GO:0051568 P histone H3-K4 methylation
RNA-seq EntryA_BomoASG_c26306_g1_i1
Sequence
(Amino Acid)
FFHNEVMRVPLYEAVPIELVMSQCWVMDLNTFCKGRPVGASESHVYICELRVDRSARLFA
KSRPKYPLCTRPYAFAHFPQRLKISRTYAPHEVSPEYLKGRGSKSAIVSTEKSNKNIPSK
EVKKKLPAITYTENTKQAAPSGGARAAAGAGRVAAQKERVN
(52 a.a.)

- SilkBase 1999-2023 -