EntryView

ORF from Assembled RNA_seq Entry

Name

O_BomoASG10389_internal:A_BomoASG_c26281_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

uncharacterized_protein_LOC101738796_[Bombyx_mori]

Ontology

GO:0000122	P	negative regulation of transcription by RNA polymerase II
GO:0001205	F	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001755	P	neural crest cell migration
GO:0001756	P	somitogenesis
GO:0001843	P	neural tube closure
GO:0003676	F	nucleic acid binding
GO:0003677	F	DNA binding
GO:0005515	F	protein binding
GO:0005634	C	nucleus
GO:0006351	P	transcription, DNA-templated
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006366	P	transcription by RNA polymerase II
GO:0007399	P	nervous system development
GO:0007417	P	central nervous system development
GO:0019208	F	phosphatase regulator activity
GO:0021540	P	corpus callosum morphogenesis
GO:0021766	P	hippocampus development
GO:0021846	P	cell proliferation in forebrain
GO:0021957	P	corticospinal tract morphogenesis
GO:0030177	P	positive regulation of Wnt signaling pathway
GO:0043507	P	positive regulation of JUN kinase activity
GO:0045636	P	positive regulation of melanocyte differentiation
GO:0045944	P	positive regulation of transcription by RNA polymerase II
GO:0046872	F	metal ion binding
GO:0048023	P	positive regulation of melanin biosynthetic process
GO:0048066	P	developmental pigmentation
GO:0048598	P	embryonic morphogenesis
GO:0048668	P	collateral sprouting
GO:0050772	P	positive regulation of axonogenesis
GO:0061373	P	mammillary axonal complex development
GO:0070412	F	R-SMAD binding
GO:0097324	P	melanocyte migration
GO:1902748	P	positive regulation of lens fiber cell differentiation
GO:1903056	P	regulation of melanosome organization

RNA-seq Entry

Sequence
(Amino Acid)

VIQISDDENDDTGVLKCKTCDLQFSTLKTLKFHMKYKHLESRLVYPCPDCLEIFSTSWSV
YRHLFKVHRKTAAQIRRLRESIQSKAFRMNNPPASYERRKNNAKAAAANKISEEERIDQE
NQAWMDNME
(42 a.a.)

- SilkBase 1999-2023 -