SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10342_complete:A_BomoASG_c26253_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		serine/threonine-protein_phosphatase_alpha-2_isoform_isoform_X1_[Helicoverpa_armigera]
Ontology
GO:0000164 C protein phosphatase type 1 complex
GO:0000781 C chromosome, telomeric region
GO:0004721 F phosphoprotein phosphatase activity
GO:0004722 F protein serine/threonine phosphatase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005975 P carbohydrate metabolic process
GO:0005977 P glycogen metabolic process
GO:0005979 P regulation of glycogen biosynthetic process
GO:0005981 P regulation of glycogen catabolic process
GO:0006470 P protein dephosphorylation
GO:0007049 P cell cycle
GO:0008157 F protein phosphatase 1 binding
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0019433 P triglyceride catabolic process
GO:0030324 P lung development
GO:0032403 F protein-containing complex binding
GO:0032922 P circadian regulation of gene expression
GO:0042587 C glycogen granule
GO:0042752 P regulation of circadian rhythm
GO:0043005 C neuron projection
GO:0043021 F ribonucleoprotein complex binding
GO:0043025 C neuronal cell body
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0043197 C dendritic spine
GO:0043204 C perikaryon
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0051301 P cell division
GO:0070062 C extracellular exosome
GO:0070688 C obsolete MLL5-L complex
GO:0072357 C PTW/PP1 phosphatase complex
GO:2001241 P positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
RNA-seq EntryA_BomoASG_c26253_g1_i1
Sequence
(Amino Acid)
MADRDTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAP
LKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENF
FLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP
DLQAMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTAGWGENDRGVSFTFGTEVVGKFLSK
HEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGALMSVDETLMCSFQILKP
ADKRKLYSGLNMGRPNTPPRAQPKNKKK
*(108 a.a.)

- SilkBase 1999-2023 -