SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10245_internal:A_BomoASG_c26168_g1_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		DNA_repair_protein_XRCC4_[Bombyx_mori]
Ontology
GO:0000793 C condensed chromosome
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005958 C DNA-dependent protein kinase-DNA ligase 4 complex
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0008022 F protein C-terminus binding
GO:0010165 P response to X-ray
GO:0016874 F ligase activity
GO:0016925 P protein sumoylation
GO:0030054 C cell junction
GO:0032807 C DNA ligase IV complex
GO:0051103 P DNA ligation involved in DNA repair
GO:0051351 P positive regulation of ligase activity
GO:0070419 C nonhomologous end joining complex
GO:0071285 P cellular response to lithium ion
GO:0075713 P establishment of integrated proviral latency
RNA-seq EntryA_BomoASG_c26168_g1_i2
Sequence
(Amino Acid)
DRKSVTKHTVQEKTFYLKVLWRWNPEELFYIYINKDNSSWSGEYSIQSANKYREEYTDDS
EEEFIENVKRAFRQNNSDFDYDFSSLKDKSSSKFTWKKRFEGKKVIQGTVNVVWDDVPTT
RETLIDNLLQENEQLKTTIRNNKVKTKAQEEELEKCKNTIEKFVDIKTTVEETLYAKFVQ
ILNEKKKRIKLLQESLQKL
(65 a.a.)

- SilkBase 1999-2023 -