SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10210_5prime_partial:A_BomoASG_c26143_g1_i1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)		checkpoint_protein_HUS1_isoform_X3_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000724 P double-strand break repair via homologous recombination
GO:0001932 P regulation of protein phosphorylation
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0008156 P negative regulation of DNA replication
GO:0009411 P response to UV
GO:0009790 P embryo development
GO:0030896 C checkpoint clamp complex
GO:0031573 P mitotic intra-S DNA damage checkpoint signaling
GO:0033314 P mitotic DNA replication checkpoint signaling
GO:0035861 C site of double-strand break
GO:0044778 P meiotic DNA integrity checkpoint signaling
GO:0071479 P cellular response to ionizing radiation
RNA-seq EntryA_BomoASG_c26143_g1_i1
Sequence
(Amino Acid)
ALPIWQIVHDIPVAVVPWKNWPDFYEPRVPDPDISIELPSLKQLRTTIDRMRTMASEVMV
RASAGGQLILQIRADMAKVSTRFKDLNVAHFDGPVDNSDPETDSQGNEDSSEIVQCRVDA
KKLALFLNVDHISTNTTLCSIVHKRLVTLCLQTDDNVKLQCFISGIVY
*(55 a.a.)

- SilkBase 1999-2023 -