SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10148_internal:A_BomoASG_c26097_g1_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		eIF-2-alpha_kinase_GCN2_isoform_X1_[Bombyx_mori]
Ontology
GO:0000049 F tRNA binding
GO:0000166 F nucleotide binding
GO:0002230 P positive regulation of defense response to virus by host
GO:0003723 F RNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004694 F eukaryotic translation initiation factor 2alpha kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006417 P regulation of translation
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007399 P nervous system development
GO:0007612 P learning
GO:0007616 P long-term memory
GO:0010998 P regulation of translational initiation by eIF2 alpha phosphorylation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019081 P viral translation
GO:0030154 P cell differentiation
GO:0032792 P negative regulation of CREB transcription factor activity
GO:0034198 P cellular response to amino acid starvation
GO:0036492 P eiF2alpha phosphorylation in response to endoplasmic reticulum stress
GO:0044828 P negative regulation by host of viral genome replication
GO:0045947 P negative regulation of translational initiation
GO:0060733 P GCN2-mediated signaling
GO:0070417 P cellular response to cold
GO:0071264 P positive regulation of translational initiation in response to starvation
GO:1900273 P positive regulation of long-term synaptic potentiation
RNA-seq EntryA_BomoASG_c26097_g1_i2
Sequence
(Amino Acid)
LTALQAIYGDAVIDNRENIAWKVWRPLDIMLTLNPLHNSDIQGVHCSVTLHLKCCNNYPD
KPPSLAIHKMHGLSTDNATKLLAELETLSHQLCGEVMIFQLAQHAQQFLHDHNKPILSFY
DEMLKQKNEMEKLKLHDLQTKEEEERQKIKDEIQRRQEILKGAGRQRVRVSSLCHDNSTE
QDCTDEKVDAPELVFYADDKMSPVKKSTRLRNMEVPCTCNTRGVQVLRVTQRNNKKVYIG
SCLGHSSTGATTYLAIDDDT
(85 a.a.)

- SilkBase 1999-2023 -