SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10104_5prime_partial:A_BomoASG_c26081_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		protein_lap4_isoform_X6_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0001736 P establishment of planar polarity
GO:0001764 P neuron migration
GO:0001944 P vasculature development
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0007275 P multicellular organism development
GO:0008283 P cell population proliferation
GO:0014021 P secondary neural tube formation
GO:0016020 C membrane
GO:0016337 P cell-cell adhesion
GO:0016477 P cell migration
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0031252 C cell leading edge
GO:0035089 P establishment of apical/basal cell polarity
GO:0042734 C presynaptic membrane
GO:0043065 P positive regulation of apoptotic process
GO:0045211 C postsynaptic membrane
GO:0045930 P negative regulation of mitotic cell cycle
GO:0046982 F protein heterodimerization activity
GO:0050918 P positive chemotaxis
GO:0060027 P convergent extension involved in gastrulation
GO:0060561 P apoptotic process involved in morphogenesis
GO:0090630 P activation of GTPase activity
GO:0097475 P motor neuron migration
RNA-seq EntryA_BomoASG_c26081_g1_i1
Sequence
(Amino Acid)
GAAPEDSAARAARRAAWRAARLRSLEQEALESQKVIKSMVGPTTEIIGEIPPRDKSPTEV
ETTQEKIISLELTTSPVSETAPCGLGEGDCSLGAEEGSLQPDIVQVVNPLLDGGAGRVTA
IPVGPDVRLTYTDAAQ
*(44 a.a.)

- SilkBase 1999-2023 -