SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG10101_5prime_partial:A_BomoASG_c26074_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
histone-lysine_N-methyltransferase_SETD2_isoform_X2_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0001570 P vasculogenesis
GO:0001763 P morphogenesis of a branching structure
GO:0001843 P neural tube closure
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006298 P mismatch repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0008168 F methyltransferase activity
GO:0010452 P histone H3-K36 methylation
GO:0010468 P regulation of gene expression
GO:0010793 P regulation of mRNA export from nucleus
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018023 P peptidyl-lysine trimethylation
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030900 P forebrain development
GO:0032259 P methylation
GO:0034728 P nucleosome organization
GO:0034968 P histone lysine methylation
GO:0035441 P cell migration involved in vasculogenesis
GO:0046975 F histone methyltransferase activity (H3-K36 specific)
GO:0048332 P mesoderm morphogenesis
GO:0048568 P embryonic organ development
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048864 P stem cell development
GO:0060039 P pericardium development
GO:0060669 P embryonic placenta morphogenesis
GO:0060977 P coronary vasculature morphogenesis
GO:0097198 P histone H3-K36 trimethylation
GO:0097676 P histone H3-K36 dimethylation
RNA-seq EntryA_BomoASG_c26074_g1_i1
Sequence
(Amino Acid)
AAVSAETSRRIKEQFRSAMAGVMVQHLNPYRHSDAPAGRITCTADFKHLARKLTHFVMLK
ELKHCRSVEELVVTDSVRSKAKTFVKKYMAKFGPVYKRPPEEAD
*(34 a.a.)

- SilkBase 1999-2023 -