SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1006_internal:A_BomoASG_c6376_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
glucosidase_precursor_[Bombyx_mori]
Ontology
GO:0000016 F lactase activity
GO:0001666 P response to hypoxia
GO:0003824 F catalytic activity
GO:0004553 F hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005903 C brush border
GO:0005975 P carbohydrate metabolic process
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0008422 F beta-glucosidase activity
GO:0009725 P response to hormone
GO:0009744 P response to sucrose
GO:0010033 P response to organic substance
GO:0010040 P response to iron(II) ion
GO:0010045 P response to nickel cation
GO:0010288 P response to lead ion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0017042 F glycosylceramidase activity
GO:0042493 P response to xenobiotic stimulus
GO:0042594 P response to starvation
GO:0043627 P response to estrogen
GO:0045471 P response to ethanol
GO:1901657 P glycosyl compound metabolic process
RNA-seq EntryA_BomoASG_c6376_g1_i1
Sequence
(Amino Acid)
AEKNIEPLVTLFHWDLPQSLQDLGGWTNSKMVDYFRDYSDVCYREFGDKIKSWITINEPY
EVCEDAYGDIKKAPALDSHGIGNYLCSDNLLKAHAESYHLYNEKYRPTQNGTVMISINSI
WYEPSDPENAEQVALAETANQFKFGWFAHPIFTN
(50 a.a.)

- SilkBase 1999-2023 -