SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/06/10
 
NameO_BomoASG10007_complete:A_BomoASG_c26000_g1_i2
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
Ontology
RNA-seq EntryA_BomoASG_c26000_g1_i2
Sequence
(Amino Acid)
MGPDQHRTDGPRDRLPGSESGHQLRLPTLSYILRTQDRACGPGRSQGEGCDVLHAGRRRQ
LEEHRVGDEAVRLRGPGVHAEAEARLQQAKTAAQEGSASR
*(32 a.a.)

- SilkBase 1999-2022 -