SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG3849_5prime_partial:A_BomaMSG_c13878_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
inositol_1,4,5-trisphosphate_receptor_isoform_X2_[Bombyx_mori]
Ontology
GO:0000280 P nuclear division
GO:0005216 F ion channel activity
GO:0005220 F inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0005262 F calcium channel activity
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006979 P response to oxidative stress
GO:0007275 P multicellular organism development
GO:0007591 P molting cycle, chitin-based cuticle
GO:0007601 P visual perception
GO:0007608 P sensory perception of smell
GO:0007629 P flight behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016319 P mushroom body development
GO:0030322 P stabilization of membrane potential
GO:0030536 P larval feeding behavior
GO:0035071 P salivary gland cell autophagic cell death
GO:0042594 P response to starvation
GO:0048016 P inositol phosphate-mediated signaling
GO:0050896 P response to stimulus
GO:0050909 P sensory perception of taste
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0051482 P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway
GO:0055085 P transmembrane transport
GO:0055089 P fatty acid homeostasis
GO:0060259 P regulation of feeding behavior
GO:0070588 P calcium ion transmembrane transport
RNA-seq EntryA_BomaMSG_c13878_g1_i1
Sequence
(Amino Acid)
LRSEKQQKELILKSTCFICGLNRSAFDNKTVSFEEHIKSEHNMWHYLYFMVLVRVKDPTE
FTGPESYVHSMIKSNNLDWFPRLRALSLMGGGEGEGGELELRALQAQLDRAHRAVATLTD
LLTDLRDQMTEQRKQKQRIGLLNSTSAYLQNLQLNLPP
*(52 a.a.)

- SilkBase 1999-2023 -