SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3837_internal:A_BomaMSG_c13836_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		myosin-IIIb-like_isoform_X2_[Bombyx_mori]
Ontology
GO:0000146 F microfilament motor activity
GO:0000166 F nucleotide binding
GO:0001917 C photoreceptor inner segment
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0007601 P visual perception
GO:0007605 P sensory perception of sound
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016459 C myosin complex
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0030175 C filopodium
GO:0030898 F microfilament motor activity
GO:0031941 C filamentous actin
GO:0032426 C stereocilium tip
GO:0032433 C filopodium tip
GO:0043531 F ADP binding
GO:0046777 P protein autophosphorylation
GO:0048839 P inner ear development
GO:0050896 P response to stimulus
GO:0051015 F actin filament binding
GO:0051491 P positive regulation of filopodium assembly
GO:0060002 F plus-end directed microfilament motor activity
RNA-seq EntryA_BomaMSG_c13836_g1_i2
Sequence
(Amino Acid)
RDRFTLQELIGEGTYGEVYCARDKKSGRRVAVKILENIAENIEEIEEEFLVFRDLSSHPN
IPEFFGLFLKRGASSDDDQIWFVMELCTGGSVTDLCAGMRAR
(33 a.a.)

- SilkBase 1999-2023 -