SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3661_5prime_partial:A_BomaMSG_c13482_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		inositol_polyphosphate_5-phosphatase_K_isoform_X2_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0001726 C ruffle
GO:0001933 P negative regulation of protein phosphorylation
GO:0004439 F phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0004445 F inositol-polyphosphate 5-phosphatase activity
GO:0005000 F vasopressin receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005979 P regulation of glycogen biosynthetic process
GO:0006469 P negative regulation of protein kinase activity
GO:0006661 P phosphatidylinositol biosynthetic process
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0010829 P negative regulation of glucose transmembrane transport
GO:0016020 C membrane
GO:0016311 P dephosphorylation
GO:0016312 F inositol bisphosphate phosphatase activity
GO:0016787 F hydrolase activity
GO:0030036 P actin cytoskeleton organization
GO:0032587 C ruffle membrane
GO:0032868 P response to insulin
GO:0032869 P cellular response to insulin stimulus
GO:0032870 P cellular response to hormone stimulus
GO:0033137 P negative regulation of peptidyl-serine phosphorylation
GO:0034485 F phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity
GO:0034594 F phosphatidylinositol trisphosphate phosphatase activity
GO:0034595 F phosphatidylinositol phosphate 5-phosphatase activity
GO:0035305 P negative regulation of dephosphorylation
GO:0035810 P positive regulation of urine volume
GO:0042577 F lipid phosphatase activity
GO:0042593 P glucose homeostasis
GO:0043005 C neuron projection
GO:0043407 P negative regulation of MAP kinase activity
GO:0043922 P negative regulation by host of viral transcription
GO:0045719 P negative regulation of glycogen biosynthetic process
GO:0045869 P negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046030 F inositol trisphosphate phosphatase activity
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0046855 P inositol phosphate dephosphorylation
GO:0046856 P phosphatidylinositol dephosphorylation
GO:0048471 C perinuclear region of cytoplasm
GO:0051497 P negative regulation of stress fiber assembly
GO:0051898 P negative regulation of protein kinase B signaling
GO:0051926 P negative regulation of calcium ion transport
GO:0052658 F inositol-1,4,5-trisphosphate 5-phosphatase activity
GO:0052659 F inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity
GO:0071320 P cellular response to cAMP
GO:0071356 P cellular response to tumor necrosis factor
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0072661 P protein localization to plasma membrane
GO:0090315 P negative regulation of protein targeting to membrane
GO:0097178 P ruffle assembly
GO:2000466 P negative regulation of glycogen (starch) synthase activity
GO:2001153 P positive regulation of renal water transport
RNA-seq EntryA_BomaMSG_c13482_g1_i1
Sequence
(Amino Acid)
AFANYTEKTVEFAPINRVWYIGDADFRTQCTLTPDIEVNPGDWIGIYDANFHNLDDYISY
EYLDKVGLSVRPASDGQPRTITLSFPVGSGVRTPGFYRFLYFSQPNSDVRSVLGISEPFE
VSSKEDKLVTLGTSEEPSTSSSPGQPKSATASTDIFNDFTGLDVAKLSRHFSNDLSID
*(58 a.a.)

- SilkBase 1999-2023 -