SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3659_complete:A_BomaMSG_c13478_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ubiquitin_conjugating_enzyme_E2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006301 P postreplication repair
GO:0006979 P response to oxidative stress
GO:0007409 P axonogenesis
GO:0007412 P axon target recognition
GO:0007625 P grooming behavior
GO:0007629 P flight behavior
GO:0007630 P jump response
GO:0008594 P photoreceptor cell morphogenesis
GO:0010942 P positive regulation of cell death
GO:0016567 P protein ubiquitination
GO:0016740 F transferase activity
GO:0031624 F ubiquitin conjugating enzyme binding
GO:0031625 F ubiquitin protein ligase binding
GO:0035370 C UBC13-UEV1A complex
GO:0045977 P positive regulation of mitotic cell cycle, embryonic
GO:0046330 P positive regulation of JNK cascade
GO:0048471 C perinuclear region of cytoplasm
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0060074 P synapse maturation
GO:0061630 F ubiquitin protein ligase activity
GO:0070534 P protein K63-linked ubiquitination
GO:0072347 P response to anesthetic
GO:1902916 P positive regulation of protein polyubiquitination
RNA-seq EntryA_BomaMSG_c13478_g1_i1
Sequence
(Amino Acid)
MAALPRRIIKETQRLMQEPVPGISAVPSETNARYFHVIVTGPEDSPFEGGLFKLELFLPE
DYPMSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAELWKVNESEAIRNAKEWTRRYAMDN
*(49 a.a.)

- SilkBase 1999-2023 -