SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3620_5prime_partial:A_BomaMSG_c13416_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		sin3_histone_deacetylase_corepressor_complex_component_SDS3_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016580 C Sin3 complex
GO:0019899 F enzyme binding
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0043065 P positive regulation of apoptotic process
GO:0045892 P negative regulation of transcription, DNA-templated
RNA-seq EntryA_BomaMSG_c13416_g1_i1
Sequence
(Amino Acid)
VQHNTAQPRKHLNSGSTCDSPIRESETCDTRVEDGKLLYERRWYHRGQSVYVEGRDLPKF
PGHIHAITDEAIWVKKTNVERIRIYVSQLARGKVTLKRRAS
*(33 a.a.)

- SilkBase 1999-2023 -