SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3538_3prime_partial:A_BomaMSG_c13185_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		collagen_type_IV_alpha-3-binding_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0000902 P cell morphogenesis
GO:0001701 P in utero embryonic development
GO:0003007 P heart morphogenesis
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006672 P ceramide metabolic process
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0006936 P muscle contraction
GO:0007029 P endoplasmic reticulum organization
GO:0007165 P signal transduction
GO:0008283 P cell population proliferation
GO:0008289 F lipid binding
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0034976 P response to endoplasmic reticulum stress
GO:0035620 F ceramide transfer activity
GO:0035621 P ER to Golgi ceramide transport
GO:0048471 C perinuclear region of cytoplasm
GO:0055088 P lipid homeostasis
GO:0070273 F phosphatidylinositol-4-phosphate binding
GO:0070584 P mitochondrion morphogenesis
GO:0097001 F ceramide binding
RNA-seq EntryA_BomaMSG_c13185_g1_i1
Sequence
(Amino Acid)
MIDENITVSDSSDLEEGGTPELRGYLSKWTNYIHGWQDRFIVLKDSTLSYYKNELESNLG
CRGALCLKKAKVKPHEFDDCRFDVSVSDCVWYLRASNPEEKQQWIDILESFKPLKADERA
VQLTVNCHRRPWTSSTPEVE
(45 a.a.)

- SilkBase 1999-2023 -