SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG3479_internal:A_BomaMSG_c13027_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101740358_isoform_X1_[Bombyx_mori]
Ontology
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001736 P establishment of planar polarity
GO:0001822 P kidney development
GO:0003007 P heart morphogenesis
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0007009 P plasma membrane organization
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007219 P Notch signaling pathway
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021987 P cerebral cortex development
GO:0022008 P neurogenesis
GO:0035329 P hippo signaling
GO:0043931 P ossification involved in bone maturation
GO:0045177 C apical part of cell
GO:0048565 P digestive tract development
GO:0060122 P inner ear receptor cell stereocilium organization
GO:0070062 C extracellular exosome
GO:0072006 P nephron development
GO:0072137 P condensed mesenchymal cell proliferation
GO:0072307 P regulation of metanephric nephron tubule epithelial cell differentiation
RNA-seq EntryA_BomaMSG_c13027_g1_i1
Sequence
(Amino Acid)
TGTERCIDLDNKYQCVCREGFTGKMCETNIDDCASNPCFNGGSCTDEVGGYKCACHPGWT
GKRCEKDIGNCVNQPCQNHAKCIDLFQDYFCVCPSGTDGKQCETAPERCIG
(36 a.a.)

- SilkBase 1999-2023 -