SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG3475_internal:A_BomaMSG_c13015_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
acetyl-CoA_carboxylase_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003824 F catalytic activity
GO:0003989 F acetyl-CoA carboxylase activity
GO:0004075 F biotin carboxylase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0006084 P acetyl-CoA metabolic process
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0008152 P metabolic process
GO:0010629 P negative regulation of gene expression
GO:0010884 P positive regulation of lipid storage
GO:0010906 P regulation of glucose metabolic process
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016874 F ligase activity
GO:0031667 P response to nutrient levels
GO:0031999 P negative regulation of fatty acid beta-oxidation
GO:0043086 P negative regulation of catalytic activity
GO:0046322 P negative regulation of fatty acid oxidation
GO:0046872 F metal ion binding
GO:0050995 P negative regulation of lipid catabolic process
GO:0051289 P protein homotetramerization
GO:0060421 P positive regulation of heart growth
GO:0097009 P energy homeostasis
GO:2001295 P malonyl-CoA biosynthetic process
RNA-seq EntryA_BomaMSG_c13015_g1_i1
Sequence
(Amino Acid)
GHDFHPENLQKLILSETSIFDILHDFFYHMNAAVCNAALEVYVRRAYTSYDIACLQHLAL
SGELGVVHFQFILPTGHPNRIPLSQSEIELSASEDKVGIPAELSAAAMRKCH
(36 a.a.)

- SilkBase 1999-2023 -