SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3471_internal:A_BomaMSG_c13000_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ribosomal_protein_S6_kinase_alpha-3-like_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0035556 P intracellular signal transduction
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:2000491 P positive regulation of hepatic stellate cell activation
RNA-seq EntryA_BomaMSG_c13000_g1_i1
Sequence
(Amino Acid)
GELGTGSFSVVRLCEHKTSRVQYAVKIMDKLQYDPREEIEILLRYSQHPHIITLRGVYEE
GGRILAVTELCRGGELLEHITQRRYLPEHEAAPILKNVLHAVHYLHAHTVVHRDIKPSNI
LFA
(40 a.a.)

- SilkBase 1999-2023 -