SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3435_3prime_partial:A_BomaMSG_c12922_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		GPI_inositol-deacylase_[Bombyx_mori]
Ontology
GO:0004518 F nuclease activity
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006505 P GPI anchor metabolic process
GO:0006506 P GPI anchor biosynthetic process
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0007605 P sensory perception of sound
GO:0009880 P embryonic pattern specification
GO:0009948 P anterior/posterior axis specification
GO:0015031 P protein transport
GO:0015798 P myo-inositol transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016788 F hydrolase activity, acting on ester bonds
GO:0021871 P forebrain regionalization
GO:0042578 F phosphoric ester hydrolase activity
GO:0060322 P head development
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_BomaMSG_c12922_g1_i1
Sequence
(Amino Acid)
MKLMKLIRSSIFQGLSLLFLLGYLLGVLNLHFSDKNNYCFMTYMFEYPQFVHLSMPENKI
YPQYALFAYSEGRFTERARKMWFDGVPVLFIPGNSGSHMQARSLASVALRKALSGDR
(38 a.a.)

- SilkBase 1999-2023 -