SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3250_internal:A_BomaMSG_c12542_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		helicase_SEN1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0005737 C cytoplasm
GO:0006353 P DNA-templated transcription, termination
GO:0006364 P rRNA processing
GO:0006369 P termination of RNA polymerase II transcription
GO:0006378 P mRNA polyadenylation
GO:0006397 P mRNA processing
GO:0008033 P tRNA processing
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008186 F ATP-dependent activity, acting on RNA
GO:0016180 P snRNA processing
GO:0016787 F hydrolase activity
GO:0017116 F single-stranded DNA helicase activity
GO:0019904 F protein domain specific binding
GO:0031124 P mRNA 3'-end processing
GO:0031126 P sno(s)RNA 3'-end processing
GO:0032508 P DNA duplex unwinding
GO:0032575 F 5'-3' RNA helicase activity
GO:0035649 C Nrd1 complex
GO:0045005 P DNA-dependent DNA replication maintenance of fidelity
GO:1990248 P regulation of transcription from RNA polymerase II promoter in response to DNA damage
RNA-seq EntryA_BomaMSG_c12542_g1_i1
Sequence
(Amino Acid)
CALPISSTFSYNFYNILVDYKVASPESRYVPRVGDIVIVGLISTSLRDQRFFFVQDVRQL
PSTSSKTHSFFCISLQGKCSDKTNIFKQGDNIIVKPLTSITKELLLFEAMDYLASSPLCS
TILNPEPSHFAKVESTVDMNLQWMKTLNHSQQTAVCASVSSAMSERPSLQMIQGPPGTGK
SSVICAIVKTYFYDGNNKKHQNRGKILICATSNAAVDELVIRLLNIRQKLPKEE
(77 a.a.)

- SilkBase 1999-2023 -