| Name | O_BomaMSG3221_internal:A_BomaMSG_c12385_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | SH3_domain-containing_kinase-binding_protein_1_isoform_X3_[Bombyx_mori] |
| Ontology |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005925 |
C |
focal adhesion |
| GO:0006897 |
P |
endocytosis |
| GO:0006915 |
P |
apoptotic process |
| GO:0007010 |
P |
cytoskeleton organization |
| GO:0008360 |
P |
regulation of cell shape |
| GO:0016020 |
C |
membrane |
| GO:0016477 |
P |
cell migration |
| GO:0017124 |
F |
SH3 domain binding |
| GO:0030054 |
C |
cell junction |
| GO:0030139 |
C |
endocytic vesicle |
| GO:0030659 |
C |
cytoplasmic vesicle membrane |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0042981 |
P |
regulation of apoptotic process |
| GO:0043005 |
C |
neuron projection |
| GO:0045202 |
C |
synapse |
|
| RNA-seq Entry | A_BomaMSG_c12385_g1_i1 |
Sequence
(Amino Acid) | VTVISKEAPDRGWWRGELHGRVGLFPDNFVQLLPAATADVEEKKPERPSKAATNSIYPIL
NKYTEKTASVKELTTSKISMHKDNPLSKETSTHSTVTHTSKNETEKFIHNEAATD
(37 a.a.) |
