SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3214_internal:A_BomaMSG_c12369_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Ig-like_and_fibronectin_type-III_domain-containing_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006470 P protein dephosphorylation
GO:0007155 P cell adhesion
GO:0007268 P chemical synaptic transmission
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0021510 P spinal cord development
GO:0021549 P cerebellum development
GO:0021766 P hippocampus development
GO:0021987 P cerebral cortex development
GO:0022038 P corpus callosum development
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0070062 C extracellular exosome
GO:0090557 P establishment of endothelial intestinal barrier
RNA-seq EntryA_BomaMSG_c12369_g1_i1
Sequence
(Amino Acid)
HSLSVSSHSATWLTLTWQPPQFSQADEKITYTLFFKSPTQMGANTTNITTTVPGYTLEKL
TPNTQYIVWVKAHAAAGDSLPSETLLAWTDPAYPAYVEPP
(32 a.a.)

- SilkBase 1999-2023 -