SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG3179_internal:A_BomaMSG_c12287_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_AATF_[Bombyx_mori]
Ontology
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005925 C focal adhesion
GO:0006974 P cellular response to DNA damage stimulus
GO:0007155 P cell adhesion
GO:0007346 P regulation of mitotic cell cycle
GO:0019904 F protein domain specific binding
GO:0032929 P negative regulation of superoxide anion generation
GO:0040016 P embryonic cleavage
GO:0042254 P ribosome biogenesis
GO:0042985 P negative regulation of amyloid precursor protein biosynthetic process
GO:0043066 P negative regulation of apoptotic process
GO:0043522 F leucine zipper domain binding
GO:0044822 F RNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048156 F tau protein binding
GO:2000378 P negative regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomaMSG_c12287_g1_i1
Sequence
(Amino Acid)
SLVEDFQHVKRQNISEEAKKGNCVRNQLLVWEGLLEMRIHLQRCVNSANQMPMPETYNEL
KSSNEFVEESNNTKLNVATVLDKLLTLQNILFNNYPETKTLTTNKRSMATSKVEQKQESD
EEIPSDTEDEEIPSDTEEDESPVSKNTKESKKSNVQANLPKKRKLDD
(54 a.a.)

- SilkBase 1999-2023 -