SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG3017_internal:A_BomaMSG_c11949_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		histone_demethylase_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0008270 F zinc ion binding
GO:0008584 P male gonad development
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0016706 F 2-oxoglutarate-dependent dioxygenase activity
GO:0019907 C cyclin-dependent protein kinase activating kinase holoenzyme complex
GO:0031490 F chromatin DNA binding
GO:0032922 P circadian regulation of gene expression
GO:0032993 C protein-DNA complex
GO:0034720 P histone H3-K4 demethylation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:1901726 P negative regulation of histone deacetylase activity
RNA-seq EntryA_BomaMSG_c11949_g1_i1
Sequence
(Amino Acid)
TIEIDLTKSNLENEVLKRNRELRRLACYGPGPKMPGLNDEEFDITKSRKRPRYDLDPLAI
YICAICQKDHRDDLLLICNGCQDTYHTFCLKPPLTAVPDGDWRCPCCIAAEVHKPAEAFG
FAQAEREYTLQQFGEMADKFKSEYFSMSGHLVPTNVAEKEFWRIISSVEEDVTVEYGADL
HS
(59 a.a.)

- SilkBase 1999-2023 -