SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2988_internal:A_BomaMSG_c11912_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_wntless_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007275 P multicellular organism development
GO:0007367 P segment polarity determination
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0010008 C endosome membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0017147 F Wnt-protein binding
GO:0030054 C cell junction
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0030285 C integral component of synaptic vesicle membrane
GO:0031227 C intrinsic component of endoplasmic reticulum membrane
GO:0031228 C intrinsic component of Golgi membrane
GO:0031302 C intrinsic component of endosome membrane
GO:0031594 C neuromuscular junction
GO:0033157 P regulation of intracellular protein transport
GO:0042734 C presynaptic membrane
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0050714 P positive regulation of protein secretion
GO:0061357 P positive regulation of Wnt protein secretion
RNA-seq EntryA_BomaMSG_c11912_g1_i1
Sequence
(Amino Acid)
VTFLLLCQLTCFLIGGLVAPMPANAQMMIATVCKDTTTVKNDTTKWFYNRGKGACQNIGL
ENLHHDLSETDFVFAFQMPLPRENMILDYSRWQQNLIGVLQIDIKYHSLMEIQPRSVITI
DARMAYRNKGDPEEQWRLYTRSVEKRNLDCDIEIKSEHHLYNCSAMPLFELGSLFHDYYL
LNIRLPVETPDMNSHIGHIHDMSL
(67 a.a.)

- SilkBase 1999-2023 -