SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2950_internal:A_BomaMSG_c11751_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
CD2-associated_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0001726 C ruffle
GO:0005172 F vascular endothelial growth factor receptor binding
GO:0005515 F protein binding
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005938 C cell cortex
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008013 F beta-catenin binding
GO:0008022 F protein C-terminus binding
GO:0016050 P vesicle organization
GO:0016337 P cell-cell adhesion
GO:0016477 P cell migration
GO:0017124 F SH3 domain binding
GO:0030139 C endocytic vesicle
GO:0031252 C cell leading edge
GO:0031941 C filamentous actin
GO:0032403 F protein-containing complex binding
GO:0032911 P negative regulation of transforming growth factor beta1 production
GO:0042995 C cell projection
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043234 C protein-containing complex
GO:0045296 F cadherin binding
GO:0048259 P regulation of receptor-mediated endocytosis
GO:0048471 C perinuclear region of cytoplasm
GO:0051301 P cell division
GO:0070062 C extracellular exosome
GO:1900182 P positive regulation of protein localization to nucleus
GO:2000249 P regulation of actin cytoskeleton reorganization
RNA-seq EntryA_BomaMSG_c11751_g1_i1
Sequence
(Amino Acid)
FPDNFVSLLNEHATTRSTGVQGRCRALYSYQPVNPDELELCVGDVLEVLGEVEEGWWQGR
RQGRVGVFPSNFVVMLDPPQPAPFELAPALPPKPVKEQCRVLFTYAAVNDDELNLNEEIG
(39 a.a.)

- SilkBase 1999-2023 -