SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2922_internal:A_BomaMSG_c11572_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_CAD_protein_[Bombyx_mori]
Ontology
GO:0000050 P urea cycle
GO:0000166 F nucleotide binding
GO:0001889 P liver development
GO:0002134 F UTP binding
GO:0003824 F catalytic activity
GO:0004070 F aspartate carbamoyltransferase activity
GO:0004087 F carbamoyl-phosphate synthase (ammonia) activity
GO:0004088 F carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0004151 F dihydroorotase activity
GO:0004672 F protein kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006207 P 'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221 P pyrimidine nucleotide biosynthetic process
GO:0006228 P UTP biosynthetic process
GO:0006520 P cellular amino acid metabolic process
GO:0006526 P arginine biosynthetic process
GO:0006541 P glutamine metabolic process
GO:0006807 P nitrogen compound metabolic process
GO:0007507 P heart development
GO:0007565 P female pregnancy
GO:0007595 P lactation
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0014075 P response to amine
GO:0016020 C membrane
GO:0016363 C nuclear matrix
GO:0016597 F amino acid binding
GO:0016740 F transferase activity
GO:0016743 F carboxyl- or carbamoyltransferase activity
GO:0016787 F hydrolase activity
GO:0016810 F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016812 F hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
GO:0016874 F ligase activity
GO:0017144 P xenobiotic metabolic process
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019899 F enzyme binding
GO:0031000 P response to caffeine
GO:0031100 P animal organ regeneration
GO:0033574 P response to testosterone
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0043195 C terminal bouton
GO:0043234 C protein-containing complex
GO:0044205 P 'de novo' UMP biosynthetic process
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0051414 P response to cortisol
GO:0070062 C extracellular exosome
GO:0071364 P cellular response to epidermal growth factor stimulus
RNA-seq EntryA_BomaMSG_c11572_g1_i1
Sequence
(Amino Acid)
QRQRRTVRDRPNYKPRGRLLNLKKMENDDLSCDLGPLCCLVLEDGTILHGRSFGAQVPVE
GEVVFQTGMVGYPESLTDPSYHAQLLVLTYPLIGNYGVPDENDRDEHGISRWFESDRIWA
AGLIVGRSEER
(42 a.a.)

- SilkBase 1999-2023 -