SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2903_internal:A_BomaMSG_c11540_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_rap_guanine_nucleotide_exchange_factor_2_[Bombyx_mori]
Ontology
GO:0001568 P blood vessel development
GO:0001764 P neuron migration
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007218 P neuropeptide signaling pathway
GO:0007264 P small GTPase mediated signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008285 P negative regulation of cell population proliferation
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0017034 F guanyl-nucleotide exchange factor activity
GO:0019901 F protein kinase binding
GO:0019933 P cAMP-mediated signaling
GO:0021591 P ventricular system development
GO:0021884 P forebrain neuron development
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030165 F PDZ domain binding
GO:0030552 F cAMP binding
GO:0031175 P neuron projection development
GO:0031547 P brain-derived neurotrophic factor receptor signaling pathway
GO:0031697 F beta-1 adrenergic receptor binding
GO:0032092 P positive regulation of protein binding
GO:0032486 P Rap protein signal transduction
GO:0038180 P nerve growth factor signaling pathway
GO:0042127 P regulation of cell population proliferation
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:0043950 P positive regulation of cAMP-mediated signaling
GO:0045202 C synapse
GO:0045860 P positive regulation of protein kinase activity
GO:0048022 P negative regulation of melanin biosynthetic process
GO:0048167 P regulation of synaptic plasticity
GO:0048471 C perinuclear region of cytoplasm
GO:0050699 F WW domain binding
GO:0050774 P negative regulation of dendrite morphogenesis
GO:0061028 P establishment of endothelial barrier
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071320 P cellular response to cAMP
GO:0071321 P cellular response to cGMP
GO:0071880 P adenylate cyclase-activating adrenergic receptor signaling pathway
GO:1901888 P regulation of cell junction assembly
GO:1990090 P cellular response to nerve growth factor stimulus
GO:2000481 P positive regulation of cAMP-dependent protein kinase activity
GO:2000670 P positive regulation of dendritic cell apoptotic process
GO:2001214 P positive regulation of vasculogenesis
GO:2001224 P positive regulation of neuron migration
RNA-seq EntryA_BomaMSG_c11540_g1_i1
Sequence
(Amino Acid)
KLQKALMKMNLLPKNTISDGLHTDDSVLSNTESLNRANTSTSFYSSHSNPDLISICYDEY
HSSDYPEHVLKVYRPDQTCKYLLVHKETTAREVVMLSVKEFGISDPSSNFSLCEVSVAQG
GIIKQHRLPDQLQNLAERIGLSSRYYLKTNG
(49 a.a.)

- SilkBase 1999-2023 -