SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2892_internal:A_BomaMSG_c11528_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
alsin_[Bombyx_mori]
Ontology
GO:0001662 P behavioral fear response
GO:0001726 C ruffle
GO:0001881 P receptor recycling
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005737 C cytoplasm
GO:0005769 C early endosome
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0006979 P response to oxidative stress
GO:0007528 P neuromuscular junction development
GO:0007626 P locomotory behavior
GO:0008104 P protein localization
GO:0014069 C postsynaptic density
GO:0016050 P vesicle organization
GO:0016197 P endosomal transport
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0030027 C lamellipodium
GO:0030425 C dendrite
GO:0030676 F guanyl-nucleotide exchange factor activity
GO:0031982 C vesicle
GO:0035023 P regulation of Rho protein signal transduction
GO:0035249 P synaptic transmission, glutamatergic
GO:0042803 F protein homodimerization activity
GO:0043087 P regulation of GTPase activity
GO:0043197 C dendritic spine
GO:0043234 C protein-containing complex
GO:0043539 F protein serine/threonine kinase activator activity
GO:0043547 P positive regulation of GTPase activity
GO:0045860 P positive regulation of protein kinase activity
GO:0048812 P neuron projection morphogenesis
GO:0051036 P regulation of endosome size
GO:0071902 P positive regulation of protein serine/threonine kinase activity
RNA-seq EntryA_BomaMSG_c11528_g1_i1
Sequence
(Amino Acid)
VNGARQGYGVMDDIGKGEKYLGNWSDNKKHGCGLIVTLDGIYYEGLFTQDVLTGHGVMVF
EDGTHYEGEFRSAGVFSGKGVLTFSSGDKIEGSLSGAWTE
(32 a.a.)

- SilkBase 1999-2023 -