SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG288_3prime_partial:A_BomaMSG_c1260_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
DNA_replication_ATP-dependent_helicase/nuclease_DNA2_[Bombyx_mori]
Ontology
GO:0000076 P DNA replication checkpoint signaling
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0000729 P DNA double-strand break processing
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0003824 F catalytic activity
GO:0004386 F helicase activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005760 C gamma DNA polymerase complex
GO:0006260 P DNA replication
GO:0006264 P mitochondrial DNA replication
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0008152 P metabolic process
GO:0016787 F hydrolase activity
GO:0016890 F site-specific endodeoxyribonuclease activity, specific for altered base
GO:0017108 F 5'-flap endonuclease activity
GO:0032508 P DNA duplex unwinding
GO:0033567 P DNA replication, Okazaki fragment processing
GO:0042645 C mitochondrial nucleoid
GO:0043137 P DNA replication, removal of RNA primer
GO:0043139 F 5'-3' DNA helicase activity
GO:0043142 F single-stranded DNA helicase activity
GO:0043504 P mitochondrial DNA repair
GO:0045740 P positive regulation of DNA replication
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:1902990 P mitotic telomere maintenance via semi-conservative replication
RNA-seq EntryA_BomaMSG_c1260_g1_i1
Sequence
(Amino Acid)
MKVMRLGSTARVDINLLHRTEKQLTASCRTVEELARLYDSMEVIGVTCLGSTHAILSRTT
FDMCIVDEATQVLQCTVLRPLFAARRFLLVGDPKQLPPIAKSRARSE
(34 a.a.)

- SilkBase 1999-2023 -