SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2791_internal:A_BomaMSG_c11347_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		cycle_like_factor_b_isoform_X3_[Bombyx_mori]
Ontology
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007283 P spermatogenesis
GO:0016605 C PML body
GO:0032007 P negative regulation of TOR signaling
GO:0032922 P circadian regulation of gene expression
GO:0033391 C chromatoid body
GO:0042634 P regulation of hair cycle
GO:0042753 P positive regulation of circadian rhythm
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045599 P negative regulation of fat cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046983 F protein dimerization activity
GO:0048511 P rhythmic process
GO:0050767 P regulation of neurogenesis
GO:0050796 P regulation of insulin secretion
GO:0051726 P regulation of cell cycle
GO:0051775 P response to redox state
GO:0070888 F E-box binding
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:0090403 P oxidative stress-induced premature senescence
GO:2000074 P regulation of type B pancreatic cell development
GO:2000772 P regulation of cellular senescence
GO:2001016 P positive regulation of skeletal muscle cell differentiation
RNA-seq EntryA_BomaMSG_c11347_g1_i2
Sequence
(Amino Acid)
IWLLYVSASVKNILHYDQSELLGQSLFDILHPKDVAKVKEQLSSSDLSPRERLIDAKTML
PLKADVVAGASRFGPGARRSFFCRIKCKLDTEEVETPPQPVKEEVEPVAKMRKKHSHEKK
YCVVQCTGYLKSWAPTKMCDGASAEGGEESEAC
(50 a.a.)

- SilkBase 1999-2023 -