SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2743_complete:A_BomaMSG_c11281_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
ubiquitin-conjugating_enzyme_E2L_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000209 P protein polyubiquitination
GO:0003713 F transcription coactivator activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008283 P cell population proliferation
GO:0016567 P protein ubiquitination
GO:0016740 F transferase activity
GO:0031398 P positive regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0044770 P cell cycle phase transition
GO:0044822 F RNA binding
GO:0051443 P positive regulation of ubiquitin-protein transferase activity
GO:0061631 F ubiquitin conjugating enzyme activity
GO:0070062 C extracellular exosome
GO:0070979 P protein K11-linked ubiquitination
GO:0071383 P cellular response to steroid hormone stimulus
GO:0071385 P cellular response to glucocorticoid stimulus
GO:0097027 F ubiquitin-protein transferase activator activity
GO:1903955 P positive regulation of protein targeting to mitochondrion
RNA-seq EntryA_BomaMSG_c11281_g1_i1
Sequence
(Amino Acid)
MAATRRLQKELNDIRQSGLKSFRDIQVDESNILTWQGLIVPDNPPYNKGAFRIEINFPAE
YPFKPPKISFKTKIYHPNIDEKGQVCLPIISAENWKPATKTDQVIQALVALVNDPEPEHP
LRAELAEEFLKDRKKFTKNAEEFTKKHSEKRPTD
*(50 a.a.)

- SilkBase 1999-2023 -