SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2727_5prime_partial:A_BomaMSG_c11264_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
rotamase_Pin1_[Bombyx_mori]
Ontology
GO:0000413 P protein peptidyl-prolyl isomerization
GO:0001934 P positive regulation of protein phosphorylation
GO:0003755 F peptidyl-prolyl cis-trans isomerase activity
GO:0003774 F cytoskeletal motor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0007049 P cell cycle
GO:0007088 P regulation of mitotic nuclear division
GO:0008013 F beta-catenin binding
GO:0016607 C nuclear speck
GO:0016853 F isomerase activity
GO:0030182 P neuron differentiation
GO:0030496 C midbody
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0032091 P negative regulation of protein binding
GO:0032465 P regulation of cytokinesis
GO:0032480 P negative regulation of type I interferon production
GO:0032794 F GTPase activating protein binding
GO:0035307 P positive regulation of protein dephosphorylation
GO:0042177 P negative regulation of protein catabolic process
GO:0043005 C neuron projection
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050808 P synapse organization
GO:0050815 F phosphoserine residue binding
GO:0050816 F phosphothreonine residue binding
GO:0050821 P protein stabilization
GO:0051443 P positive regulation of ubiquitin-protein transferase activity
GO:0060393 P regulation of pathway-restricted SMAD protein phosphorylation
GO:0061051 P positive regulation of cell growth involved in cardiac muscle cell development
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1900180 P regulation of protein localization to nucleus
GO:1901796 P regulation of signal transduction by p53 class mediator
GO:2000146 P negative regulation of cell motility
RNA-seq EntryA_BomaMSG_c11264_g1_i1
Sequence
(Amino Acid)
LFRSVKNFLHQLRKSKNQLTFPAQRTNDMASTQEEILPEGWEARKSRSTGMTYYLNKHTK
KSQWEKPGGPASDDDDEDDDDEGGIPKEVRCSHLLVKHSGSRRPSSWREEHITRTKEEAL
DILQEYRRKIIDREAKFEELASTYSDCSSAKRDGDLGRFKKGQMQKPFEDVAFALKIGQL
SQPVHTDSGIHIILRTA
*(65 a.a.)

- SilkBase 1999-2023 -