SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2722_internal:A_BomaMSG_c11256_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
DNA_repair_and_recombination_protein_RAD54-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000711 P meiotic DNA repair synthesis
GO:0000724 P double-strand break repair via homologous recombination
GO:0003674 F molecular_function
GO:0003677 F DNA binding
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006338 P chromatin remodeling
GO:0006417 P regulation of translation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0008298 P intracellular mRNA localization
GO:0010212 P response to ionizing radiation
GO:0016787 F hydrolase activity
GO:0016817 F hydrolase activity, acting on acid anhydrides
GO:0030261 P chromosome condensation
GO:0043150 P DNA synthesis involved in double-strand break repair via homologous recombination
GO:0045003 P double-strand break repair via synthesis-dependent strand annealing
GO:0046843 P dorsal appendage formation
GO:0048477 P oogenesis
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
RNA-seq EntryA_BomaMSG_c11256_g1_i1
Sequence
(Amino Acid)
RWHGYEQAMARVWRDGQKKPCYIYRLLATGTIEEKIFQRQAHKKALSETVVDQNEESLRH
FTADDLKDLFRLEENTLSDTHSKFKCKRCVNNIQVTLPPENSDCTSDISNWYHCADKKNL
ADMVLKQCWDIAKSISFVFHHRSAKTEAKEITIEDKENIQVSKKK
(54 a.a.)

- SilkBase 1999-2023 -