SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG271_internal:A_BomaMSG_c1204_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
zinc_finger_protein_99_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007362 P terminal region determination
GO:0007366 P periodic partitioning by pair rule gene
GO:0007442 P hindgut morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0009880 P embryonic pattern specification
GO:0010906 P regulation of glucose metabolic process
GO:0016348 P imaginal disc-derived leg joint morphogenesis
GO:0035220 P wing disc development
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046331 P lateral inhibition
GO:0046872 F metal ion binding
GO:0048617 P embryonic foregut morphogenesis
GO:0048619 P embryonic hindgut morphogenesis
RNA-seq EntryA_BomaMSG_c1204_g1_i1
Sequence
(Amino Acid)
ELRQHRAIHSDDKPFACDKCDKTFKTYSNLKTHMDIHEDTSYECFICRRVLNSRRTLRKH
LLVHEDKCRHVCSYCNKAFKRRQTLKASCPVNQVTVITITRFTCIP
(34 a.a.)

- SilkBase 1999-2023 -