SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2712_5prime_partial:A_BomaMSG_c11241_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
zinc_finger_protein_845_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008285 P negative regulation of cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0015271 F outward rectifier potassium channel activity
GO:0017053 C transcription repressor complex
GO:0032348 P negative regulation of aldosterone biosynthetic process
GO:0032403 F protein-containing complex binding
GO:0035690 P cellular response to xenobiotic stimulus
GO:0043065 P positive regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043922 P negative regulation by host of viral transcription
GO:0044212 F transcription cis-regulatory region binding
GO:0045665 P negative regulation of neuron differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045955 P negative regulation of calcium ion-dependent exocytosis
GO:0046676 P negative regulation of insulin secretion
GO:0046872 F metal ion binding
GO:0050768 P negative regulation of neurogenesis
GO:0060379 P cardiac muscle cell myoblast differentiation
GO:0070933 P histone H4 deacetylation
GO:0071257 P cellular response to electrical stimulus
GO:0071385 P cellular response to glucocorticoid stimulus
GO:0071805 P potassium ion transmembrane transport
GO:2000065 P negative regulation of cortisol biosynthetic process
GO:2000706 P negative regulation of dense core granule biogenesis
GO:2000798 P negative regulation of amniotic stem cell differentiation
RNA-seq EntryA_BomaMSG_c11241_g2_i1
Sequence
(Amino Acid)
NYSQNYSNAEDFLPKELLNYTEISNELPLTYSTPYSDKIDKKNIQVLDSNDRERPFGCSH
CNYISKFKATVQRHYQRHHTDDKRPYHCSNCDFKTKTKDQIALHNKRSASSLEMRCQNCD
FTTNFKCQFVMHQRSHYTFKCELCNYTCKHKHEIEKHVRTIHMGTKHLCKYCDFKTPKLE
ALLCHEALHTGNKPFKCKLCDYQTVRLSLLDIHVRRYHSDLKVVKLISESKVQSLKVSVP
PDECS
*(81 a.a.)

- SilkBase 1999-2023 -