SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2700_internal:A_BomaMSG_c11235_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_tramtrack,_beta_isoform_isoform_X5_[Bombyx_mori]
Ontology
GO:0000794 C condensed nuclear chromosome
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007435 P salivary gland morphogenesis
GO:0016458 P obsolete gene silencing
GO:0016568 P chromatin organization
GO:0031208 F POZ domain binding
GO:0031519 C PcG protein complex
GO:0035167 P larval lymph gland hemopoiesis
GO:0042803 F protein homodimerization activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
RNA-seq EntryA_BomaMSG_c11235_g1_i1
Sequence
(Amino Acid)
VHAHKLILSVCSPYFKELFKMNPCEHPIVILKDVELQELRQLLQFMYRGEVHVRQQELSG
FLHTAELLQVKGLTGGREKSESPPPVTEEKQVTKPSISEPSPESQQEWVP
(35 a.a.)

- SilkBase 1999-2023 -