SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2693_internal:A_BomaMSG_c11212_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		muscarinic_acetylcholine_receptor_DM1_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007197 P adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200 P phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007207 P phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway
GO:0007213 P G protein-coupled acetylcholine receptor signaling pathway
GO:0007271 P synaptic transmission, cholinergic
GO:0008227 F G protein-coupled amine receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016907 F G protein-coupled acetylcholine receptor activity
GO:0030054 C cell junction
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
RNA-seq EntryA_BomaMSG_c11212_g1_i1
Sequence
(Amino Acid)
HRWRESKPSCARPPKRGWAVVRAWCVAWWHSGREDTEDTEPEEEPSDPGYATPVSVETPL
QSSVPRCTSLNVIRDPYATRGGSSGSGDGGTSPLRRTYEPPGMVTSARDSRSLPPNTRIN
TTTSPAPKSASADSVYTIVIRLPDADTERATIKMITEESPPSMARPHYRPTRGDSELNR
(58 a.a.)

- SilkBase 1999-2023 -