SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2649_internal:A_BomaMSG_c11133_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
histone-lysine_N-methyltransferase_trithorax_[Bombyx_mori]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005875 C microtubule associated complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0008023 C transcription elongation factor complex
GO:0008157 F protein phosphatase 1 binding
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0008354 P germ cell migration
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0019233 P sensory perception of pain
GO:0032259 P methylation
GO:0032968 P positive regulation of transcription elongation from RNA polymerase II promoter
GO:0035097 C histone methyltransferase complex
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0043966 P histone H3 acetylation
GO:0044212 F transcription cis-regulatory region binding
GO:0044665 C MLL1/2 complex
GO:0046872 F metal ion binding
GO:0048096 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0051568 P histone H3-K4 methylation
GO:2001020 P regulation of response to DNA damage stimulus
RNA-seq EntryA_BomaMSG_c11133_g1_i1
Sequence
(Amino Acid)
LPISQPVYYGLETIVQNTVMSSQQFVSTAMQGVLAQNSSFSATTTQVFQASKIEPIVEVP
TGYVVVNNVGDNVSSSTPNVVTAQSVQSSPASMKAVKTTVPNLTLQPLTEKALNNSIRQT
P
(39 a.a.)

- SilkBase 1999-2023 -