SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2626_internal:A_BomaMSG_c11054_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
low-density_lipoprotein_receptor-related_protein_6_[Bombyx_mori]
Ontology
GO:0001702 P gastrulation with mouth forming second
GO:0001756 P somitogenesis
GO:0001843 P neural tube closure
GO:0001933 P negative regulation of protein phosphorylation
GO:0001947 P heart looping
GO:0002053 P positive regulation of mesenchymal cell proliferation
GO:0003344 P pericardium morphogenesis
GO:0003401 P axis elongation
GO:0005041 F low-density lipoprotein particle receptor activity
GO:0005102 F signaling receptor binding
GO:0005109 F frizzled binding
GO:0005515 F protein binding
GO:0005769 C early endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0006469 P negative regulation of protein kinase activity
GO:0006897 P endocytosis
GO:0007268 P chemical synaptic transmission
GO:0007275 P multicellular organism development
GO:0009880 P embryonic pattern specification
GO:0009950 P dorsal/ventral axis specification
GO:0009952 P anterior/posterior pattern specification
GO:0009986 C cell surface
GO:0014029 P neural crest formation
GO:0014033 P neural crest cell differentiation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0017147 F Wnt-protein binding
GO:0019210 F kinase inhibitor activity
GO:0019534 F toxin transmembrane transporter activity
GO:0021587 P cerebellum morphogenesis
GO:0021794 P thalamus development
GO:0021795 P cerebral cortex cell migration
GO:0021861 P forebrain radial glial cell differentiation
GO:0021872 P forebrain generation of neurons
GO:0021874 P Wnt signaling pathway involved in forebrain neuroblast division
GO:0021915 P neural tube development
GO:0021943 P formation of radial glial scaffolds
GO:0021987 P cerebral cortex development
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030326 P embryonic limb morphogenesis
GO:0030900 P forebrain development
GO:0030901 P midbrain development
GO:0030917 P midbrain-hindbrain boundary development
GO:0031410 C cytoplasmic vesicle
GO:0034392 P negative regulation of smooth muscle cell apoptotic process
GO:0035108 P limb morphogenesis
GO:0035115 P embryonic forelimb morphogenesis
GO:0035116 P embryonic hindlimb morphogenesis
GO:0035261 P external genitalia morphogenesis
GO:0036342 P post-anal tail morphogenesis
GO:0042074 P cell migration involved in gastrulation
GO:0042127 P regulation of cell population proliferation
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042733 P embryonic digit morphogenesis
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042813 F Wnt-activated receptor activity
GO:0043025 C neuronal cell body
GO:0043065 P positive regulation of apoptotic process
GO:0043235 C receptor complex
GO:0044332 P Wnt signaling pathway involved in dorsal/ventral axis specification
GO:0045202 C synapse
GO:0045599 P negative regulation of fat cell differentiation
GO:0045778 P positive regulation of ossification
GO:0045780 P positive regulation of bone resorption
GO:0045787 P positive regulation of cell cycle
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046849 P bone remodeling
GO:0048596 P embryonic camera-type eye morphogenesis
GO:0048699 P generation of neurons
GO:0048705 P skeletal system morphogenesis
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051593 P response to folic acid
GO:0060021 P roof of mouth development
GO:0060026 P convergent extension
GO:0060042 P retina morphogenesis in camera-type eye
GO:0060059 P embryonic retina morphogenesis in camera-type eye
GO:0060070 P canonical Wnt signaling pathway
GO:0060284 P regulation of cell development
GO:0060325 P face morphogenesis
GO:0060444 P branching involved in mammary gland duct morphogenesis
GO:0060535 P trachea cartilage morphogenesis
GO:0060596 P mammary placode formation
GO:0060603 P mammary gland duct morphogenesis
GO:0061310 P canonical Wnt signaling pathway involved in cardiac neural crest cell differentiation involved in heart development
GO:0061324 P canonical Wnt signaling pathway involved in positive regulation of cardiac outflow tract cell proliferation
GO:0071397 P cellular response to cholesterol
GO:0071542 P dopaminergic neuron differentiation
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:0071936 F coreceptor activity involved in Wnt signaling pathway
GO:0072659 P protein localization to plasma membrane
GO:0090009 P primitive streak formation
GO:0090118 P receptor-mediated endocytosis involved in cholesterol transport
GO:0090244 P Wnt signaling pathway involved in somitogenesis
GO:0090245 P axis elongation involved in somitogenesis
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1901998 P toxin transport
GO:1990851 C Wnt-Frizzled-LRP5/6 complex
GO:1990909 C Wnt signalosome
GO:2000051 P negative regulation of non-canonical Wnt signaling pathway
GO:2000055 P positive regulation of Wnt signaling pathway involved in dorsal/ventral axis specification
GO:2000149 P negative regulation of planar cell polarity pathway involved in ventricular septum morphogenesis
GO:2000151 P negative regulation of planar cell polarity pathway involved in cardiac muscle tissue morphogenesis
GO:2000162 P negative regulation of planar cell polarity pathway involved in cardiac right atrium morphogenesis
GO:2000164 P negative regulation of planar cell polarity pathway involved in outflow tract morphogenesis
GO:2000166 P negative regulation of planar cell polarity pathway involved in pericardium morphogenesis
GO:2000168 P negative regulation of planar cell polarity pathway involved in neural tube closure
RNA-seq EntryA_BomaMSG_c11054_g1_i2
Sequence
(Amino Acid)
VLFRSFGLTLLDDYLYWTDMQKRTLDRINKNTGLDRQPVVEQMANMMGVKAFRLGAPLGW
NPCADDNGGCSHLCFNRPDDYICGCPLGLELTADKKTCVEPEAFLVYSRKNIIGR
(37 a.a.)

- SilkBase 1999-2023 -