SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2620_internal:A_BomaMSG_c11050_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
phospholipase_C_gamma_isoform_X1_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0001726 C ruffle
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0004435 F phosphatidylinositol phospholipase C activity
GO:0004871 F obsolete signal transducer activity
GO:0005168 F neurotrophin TRKA receptor binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0006629 P lipid metabolic process
GO:0007165 P signal transduction
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0008081 F phosphoric diester hydrolase activity
GO:0008180 C COP9 signalosome
GO:0009395 P phospholipid catabolic process
GO:0010634 P positive regulation of epithelial cell migration
GO:0016042 P lipid catabolic process
GO:0016477 P cell migration
GO:0016787 F hydrolase activity
GO:0019722 P calcium-mediated signaling
GO:0019901 F protein kinase binding
GO:0030027 C lamellipodium
GO:0030971 F receptor tyrosine kinase binding
GO:0035254 F glutamate receptor binding
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0043536 P positive regulation of blood vessel endothelial cell migration
GO:0045766 P positive regulation of angiogenesis
GO:0046872 F metal ion binding
GO:0050852 P T cell receptor signaling pathway
GO:0051281 P positive regulation of release of sequestered calcium ion into cytosol
GO:0071364 P cellular response to epidermal growth factor stimulus
RNA-seq EntryA_BomaMSG_c11050_g1_i1
Sequence
(Amino Acid)
ENKLYYTESYNSQEETDTESDGDSDAENAIVPQDELHFAECWFHGKLAGNRQEAEDLLRA
HAHLGDGTFLVRESVTFVGDYCLSFWRQGKVNHCRIKLKQERGVTKFYLIDSMCFD
(37 a.a.)

- SilkBase 1999-2023 -