| Name | O_BomaMSG257_internal:A_BomaMSG_c1144_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | Exocyst_complex_component_2_[Papilio_machaon] |
| Ontology |
| GO:0000145 |
C |
exocyst |
| GO:0001927 |
P |
exocyst assembly |
| GO:0005515 |
F |
protein binding |
| GO:0005829 |
C |
cytosol |
| GO:0005886 |
C |
plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006887 |
P |
exocytosis |
| GO:0006893 |
P |
Golgi to plasma membrane transport |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0017160 |
F |
small GTPase binding |
| GO:0019901 |
F |
protein kinase binding |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0047485 |
F |
protein N-terminus binding |
| GO:2000535 |
P |
regulation of entry of bacterium into host cell |
|
| RNA-seq Entry | A_BomaMSG_c1144_g1_i1 |
Sequence
(Amino Acid) | DSVCGASAGRYVRDICETVCEEVARLAACAPPALPRPAAFRATLEYTLLSVAIRDHLTRK
AENYLKEALAAVPPLELEEDKIRMKNIVEDFKKRMALQLASLNCNTETDRKS
(36 a.a.) |
